CNOT3 (CCR4-NOT Transcription Complex, Subunit 3, KIAA0691, LENG2, NOT3, NOT3H) (Biotin), Clone: [100000000], Mouse, Monoclonal

Catalog Number: USB-244807-BIOTIN
Article Name: CNOT3 (CCR4-NOT Transcription Complex, Subunit 3, KIAA0691, LENG2, NOT3, NOT3H) (Biotin), Clone: [100000000], Mouse, Monoclonal
Biozol Catalog Number: USB-244807-BIOTIN
Supplier Catalog Number: 244807-Biotin
Alternative Catalog Number: USB-244807-BIOTIN-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Immunogen: CNOT3 (NP_055331, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Mouse monoclonal antibody raised against a partial recombinant CNOT3. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRDQIKTWVASNEIKDKRQLIDNRKLIETQMERFKVVERETKT Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [100000000]
NCBI: 055331
Purity: Purified
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.