CNOT3 (CCR4-NOT Transcription Complex, Subunit 3, KIAA0691, LENG2, NOT3, NOT3H) (HRP), Clone: [100000000], Mouse, Monoclonal

Catalog Number: USB-244807-HRP
Article Name: CNOT3 (CCR4-NOT Transcription Complex, Subunit 3, KIAA0691, LENG2, NOT3, NOT3H) (HRP), Clone: [100000000], Mouse, Monoclonal
Biozol Catalog Number: USB-244807-HRP
Supplier Catalog Number: 244807-HRP
Alternative Catalog Number: USB-244807-HRP-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Immunogen: CNOT3 (NP_055331, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Mouse monoclonal antibody raised against a partial recombinant CNOT3. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRDQIKTWVASNEIKDKRQLIDNRKLIETQMERFKVVERETKT Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [100000000]
NCBI: 055331
Purity: Purified
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).