CNOT3 (CCR4-NOT Transcription Complex, Subunit 3, KIAA0691, LENG2, NOT3, NOT3H) (MaxLight 650), Clone: [100000000], Mouse, Monoclonal

Catalog Number: USB-244807-ML650
Article Name: CNOT3 (CCR4-NOT Transcription Complex, Subunit 3, KIAA0691, LENG2, NOT3, NOT3H) (MaxLight 650), Clone: [100000000], Mouse, Monoclonal
Biozol Catalog Number: USB-244807-ML650
Supplier Catalog Number: 244807-ML650
Alternative Catalog Number: USB-244807-ML650-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, WB
Immunogen: CNOT3 (NP_055331, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
MaxLight(TM)650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor(TM)647, DyLight(TM)649, Cy5(TM) and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm), Emission (676nm), Extinction Coefficient 250,000. Mouse monoclonal antibody raised against a partial recombinant CNOT3. Applications: Suitable for use in FLISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRDQIKTWVASNEIKDKRQLIDNRKLIETQMERFKVVERETKT Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [100000000]
NCBI: 055331
Purity: Purified
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight(TM)650.