COG2 (Component of Oligomeric Golgi Complex 2, LDLC), Clone: [3H8], Mouse, Monoclonal

Catalog Number: USB-244821
Article Name: COG2 (Component of Oligomeric Golgi Complex 2, LDLC), Clone: [3H8], Mouse, Monoclonal
Biozol Catalog Number: USB-244821
Supplier Catalog Number: 244821
Alternative Catalog Number: USB-244821-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Immunogen: COG2 (NP_031383, 639aa-738aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
This gene encodes a subunit of the conserved oligomeric Golgi complex that is required for maintaining normal structure and activity of the Golgi complex. The encoded protein specifically interacts with the USO1 vesicle docking protein and may be necessary for normal Golgi ribbon formation and trafficking of Golgi enzymes. Mutations of this gene are associated with abnormal glycosylation within the Golgi apparatus. Alternative splicing results in multiple transcript variants Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LSESTHKYYETVSDVLNSVKKMEESLKRLKQARKTTPANPVGPSGGMSDDDKIRLQLALDVEYLGEQIQKLGLQASDIKSFSALAELVMouse monoclonal antibody raised against a partial recombinant COG2.KDQATAEQP Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clonality: Monoclonal
Clone Designation: [3H8]
NCBI: 031383
Purity: Purified
Form: Supplied as a liquid in PBS, pH 7.4.