COL21A1 (Collagen, Type XXI, alpha 1, COLA1L, DKFZp564B052, FLJ39125, FLJ44623, FP633, MGC26619, dJ682J15.1, dJ708F5.1) (APC), Clone: [1G6], Mouse, Monoclonal

Catalog Number: USB-244829-APC
Article Name: COL21A1 (Collagen, Type XXI, alpha 1, COLA1L, DKFZp564B052, FLJ39125, FLJ44623, FP633, MGC26619, dJ682J15.1, dJ708F5.1) (APC), Clone: [1G6], Mouse, Monoclonal
Biozol Catalog Number: USB-244829-APC
Supplier Catalog Number: 244829-APC
Alternative Catalog Number: USB-244829-APC-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, WB
Immunogen: COL21A1 (NP_110447, 221aa-320aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
This gene encodes the alpha chain of type XXI collagen, a member of the FACIT collagen family (fibril-associated collagens with interrupted helices). Type XXI collagen is localized to tissues containing type I collagen so, like other members of this collagen family, it may serve to maintain the integrity of the extracellular matrix. An alternatively spliced transcript variant has been described, but its full-length nature has yet to be determined. [provided by RefSeq Applications: Suitable for use in FLISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IPVAARDERGFDILLGLDVNKKVKKRIQLSPKKIKGYEVTSKVDLSELTSNVFPEGLPPSYVFVSTQRFKVKKIWDLWRILTIDGRPQIAVTLNGVDKIL Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [1G6]
NCBI: 110447
Purity: Purified
Form: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).