COL5A2 (Collagen, Type V, alpha 2, MGC105115), Clone: [3G11], Mouse, Monoclonal

Catalog Number: USB-244839
Article Name: COL5A2 (Collagen, Type V, alpha 2, MGC105115), Clone: [3G11], Mouse, Monoclonal
Biozol Catalog Number: USB-244839
Supplier Catalog Number: 244839
Alternative Catalog Number: USB-244839-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, IF, WB
Immunogen: COL5A2 (NP_000384, 41aa-124aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
This gene encodes an alpha chain for one of the low abundance fibrillar collagens. Fibrillar collagen molecules are trimers that can be composed of one or more types of alpha chains. Type V collagen is found in tissues containing type I collagen and appears to regulate the assembly of heterotypic fibers composed of both type I and type V collagen. This gene product is closely related to type XI collagen and it is possible that the collagen chains of types V and XI constitute a single collagen type with tissue-specific chain combinations. Mutations in this gene are associated with Ehlers-Danlos syndrome, types I and II. [provided by RefSeq Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: CTQNGQMYLNRDIWKPAPCQICVCDNGAILCDKIECQDVLDCADPVTPPGECCPVCSQTPGGGNTNFGRGRKGQKGEPGLVPVV Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clonality: Monoclonal
Clone Designation: [3G11]
NCBI: 000384
Purity: Purified
Form: Supplied as a liquid in PBS, pH 7.4.