IVNS1ABP (influenza Virus NS1A Binding Protein, DKFZp686K06216, FLARA3, FLJ10069, FLJ10411, FLJ10962, FLJ35593, FLJ36593, HSPC068, KIAA0850, ND1, NS-1, NS1-BP, NS1BP), Clone: [4B1], Mouse, Monoclonal

Catalog Number: USB-247771
Article Name: IVNS1ABP (influenza Virus NS1A Binding Protein, DKFZp686K06216, FLARA3, FLJ10069, FLJ10411, FLJ10962, FLJ35593, FLJ36593, HSPC068, KIAA0850, ND1, NS-1, NS1-BP, NS1BP), Clone: [4B1], Mouse, Monoclonal
Biozol Catalog Number: USB-247771
Supplier Catalog Number: 247771
Alternative Catalog Number: USB-247771-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Immunogen: IVNS1ABP (NP_006460.2, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Mouse monoclonal antibody raised against a partial recombinant IVNS1ABP. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLKADKE Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clonality: Monoclonal
Clone Designation: [4B1]
NCBI: 006460
Purity: Purified
Form: Supplied as a liquid in PBS, pH 7.4.