IVNS1ABP (influenza Virus NS1A Binding Protein, DKFZp686K06216, FLARA3, FLJ10069, FLJ10411, FLJ10962, FLJ35593, FLJ36593, HSPC068, KIAA0850, ND1, NS-1, NS1-BP, NS1BP) (MaxLight 550), Clone: [4B1], Mouse, Monoclonal

Catalog Number: USB-247771-ML550
Article Name: IVNS1ABP (influenza Virus NS1A Binding Protein, DKFZp686K06216, FLARA3, FLJ10069, FLJ10411, FLJ10962, FLJ35593, FLJ36593, HSPC068, KIAA0850, ND1, NS-1, NS1-BP, NS1BP) (MaxLight 550), Clone: [4B1], Mouse, Monoclonal
Biozol Catalog Number: USB-247771-ML550
Supplier Catalog Number: 247771-ML550
Alternative Catalog Number: USB-247771-ML550-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, WB
Immunogen: IVNS1ABP (NP_006460.2, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
MaxLight(TM)550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor(TM)546, 555, DyLight(TM)549 , Cy3(TM), TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm), Emission (575nm), Extinction Coefficient 150,000. Mouse monoclonal antibody raised against a partial recombinant IVNS1ABP. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLKADKE Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [4B1]
NCBI: 006460
Purity: Purified
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight(TM)550.