Endogenous APJ receptor agonist (EC50 = 20 nM) that is secreted by adipocytes. Binds with high affinity to human APJ receptors expressed in HEK 293 cells (pIC50= 8.61). Involved in regulation of cardiovascular function, fluid homeostasis and feeding. Blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ. CAS Number: 252642-12-9 Molecular Weight: 4195.87 Counter Ion: TFA Molecular Formula: C184H297N69O43S Mass Spectrum: Consistent with structure Sequence: LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF Solubility: 1mg/ml in water Storage: Desiccate at -20C
Purity:
~97% (HPLC)
Form:
Supplied as a white, lyophilized solid.
CAS Number:
[252642-12-9]
* VAT and and shipping costs not included. Errors and price changes excepted
