Potent KV1.3 channel blocker (IC50 = 36 pM). Displays no effect at calcium-activated channels. Reduces VEGF-induced transmembrane calcium influxes and nitric oxide production in human endothelial cells. CAS Number: 145808-47-5 Molecular Formula: C178H286N52O50S7 Sequence: TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH (Modifications: Disulfide bridge between 7 - 29, 13 - 34, 17 - 36) Solubility: Soluble to 0.5mg/ml in water Storage and Stability: Store at -20C. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Purity:
>95.6% (HPLC)
Form:
Supplied as a white lyophilized solid.
CAS Number:
[145808-47-5]
* VAT and and shipping costs not included. Errors and price changes excepted
