Parathyroid Hormone Related Peptide, Human, aa53-86 (PTHrP)
Biozol Catalog Number:
USB-298230
Supplier Catalog Number:
298230
Alternative Catalog Number:
USB-298230-100,USB-298230-1
Manufacturer:
US Biological
Category:
Molekularbiologie
The protein encoded by this gene is a member of the parathyroid hormone family. This hormone, via its receptor, PTHR1, regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. It is responsible for most cases of humoral hypercalcemia of malignancy, and mutations in this gene are associated with brachydactyly type E2 (BDE2). Alternatively spliced transcript variants have been found for this gene. There is also evidence for alternative translation initiation from non-AUG (CUG and GUG) start sites, downstream of the initiator AUG codon, resulting in nuclear forms of this hormone. [provided by RefSeq, Nov 2013] Source: Synthetic human PTHrP AA Sequence: KNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile acetic acid. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Purity:
95% (HPLC)
Form:
Supplied as a lyophilized powder. Reconstitute with 0.1% acetic acid.
* VAT and and shipping costs not included. Errors and price changes excepted