This gene belongs to the family defined by the mouse resistin-like genes. The characteristic feature of this family is the C-terminal stretch of 10 cys residues with identical spacing. The mouse homolog of this protein is secreted by adipocytes, and may be the hormone potentially linking obesity to type II diabetes. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2010] Source: Synthetic human Resistin AA Sequence: CQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMD WTGARCCRVQP Storage and Stability: Lyophilized powder may be stored at -20C. Stable for 12 months after receipt at -20C. Reconstitute with sterile buffer. Aliquot to avoid repeated freezing and thawing. Store at -20C. Reconstituted product is stable for 6 months at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Purity:
~95% (HPLC)
Form:
Supplied as a lyophilized powder. Reconstitute with 0.1% acetic acid.
* VAT and and shipping costs not included. Errors and price changes excepted
