Thymosin B4, Human, CT (T beta-4, Fx, TMSB4X, TB4X, THYB4, TMSB4) (Biotin)

Catalog Number: USB-298296
Article Name: Thymosin B4, Human, CT (T beta-4, Fx, TMSB4X, TB4X, THYB4, TMSB4) (Biotin)
Biozol Catalog Number: USB-298296
Supplier Catalog Number: 298296
Alternative Catalog Number: USB-298296-100
Manufacturer: US Biological
Category: Molekularbiologie
Plays an important role in the organization of the cytoskeleton (By similarity). Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization. Source: Synthetic human Thymosin B4, at C-terminal AA Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES-L-Biotin. Underlined amino acids were added or modified for technical reasons. Storage and Stability: Lyophilized powder may be stored at -20C. Stable for 12 months after receipt at -20C. Reconstitute with sterile buffer. Aliquot to avoid repeated freezing and thawing. Store at -20C. Reconstituted product is stable for 6 months at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 5.2
UniProt: P62328
Purity: ~95% (HPLC)
Form: Supplied as a lyophilized powder. Reconstitute with 0.1% acetic acid. Labeled with Biotin.