TIP 39, Human, aa62-100 (Tuberoinfundibular Peptide of 39 Residues)
Biozol Catalog Number:
USB-298303
Supplier Catalog Number:
298303
Alternative Catalog Number:
USB-298303-100,USB-298303-1
Manufacturer:
US Biological
Category:
Molekularbiologie
Plays a role as a potent and selective agonist of PTH2R resulting in adenyl cyclase activation and intracellular calcium levels elevation. Induces protein kinase C beta activation, recruitment of beta-arrestin and PTH2R internalization. May inhibit cell proliferation via its action on PTH2R activation. Neuropeptide which may also have a role in spermatogenesis. May activate nociceptors and nociceptive circuits. Source: Synthetic human TIP 39 Amino Acid Sequence: SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile 0.1% acetic acid. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
