ASH1L, Recombinant, Human, aa2433-2548, His-Tag (Ash1 (Absent, Small or Homeotic)-Like, KMT2H, ASH1-Like Protein, Ash1, HuASH1, EC 2.1.1.43)

Product Overview

• Article Name: ASH1L, Recombinant, Human, aa2433-2548, His-Tag (Ash1 (Absent, Small or Homeotic)-Like, KMT2H, ASH1-Like Protein, Ash1, HuASH1, EC 2.1.1.43)
• Biozol Catalog Number: USB-298323
• Supplier Catalog Number: 298323
• Alternative Catalog Number: USB-298323-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

This gene encodes a member of the trithorax group of transcriptional activators. The protein contains four AT hooks, a SET domain, a PHD-finger motif, and a bromodomain. It is localized to many small speckles in the nucleus, and also to cell-cell tight junctions. [provided by RefSeq, Jul 2008] Source: Recombinant protein corresponding to aa2433-2548 from human bromodomain ash1 (absent, small or homeotic)-like, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~14.2kD AA Sequence: MHHHHHHEVARAARLAQIFKEICDGIISYKDSSRQALAAPLLNLPPKKKNADYYEKISD PLDLITIEKQILTGYYKTVEAFDADMLKVFRNAEKYYGRKSPVGRDVCRLRKAYYNAR HEASAQ Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Product Properties

• Molecular Weight: 14.2
• NCBI: 018489
• UniProt: Q9NR48
• Purity: Highly Purified (~90%)
• Form: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 0.04% Tween 20, 20% glycerol.