BAZ1A, Recombinant, Human, aa1415-1545, GST-tag (Bromodomain Adjacent to Zinc Finger Domain 1A, ACF1)

Product Overview

• Article Name: BAZ1A, Recombinant, Human, aa1415-1545, GST-tag (Bromodomain Adjacent to Zinc Finger Domain 1A, ACF1)
• Biozol Catalog Number: USB-298330
• Supplier Catalog Number: 298330
• Alternative Catalog Number: USB-298330-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

The BAZ1A gene encodes the accessory subunit of the ATP-dependent chromatin assembly factor (ACF), a member of the ISWI (imitation switch) family of chromatin remodeling complexes (summarized by Racki et al., 2009 [PubMed 20033039]).[supplied by OMIM, Apr 2010] Source: Recombinant protein corresponding to aa1415-1545 from human BAZ1A, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~42kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSEPSPV TLGRRSSGRQGGVHELSAFEQLVVELVRHDDSWPFLKLVSKIQVPDYYDIIKKPIALNII REKVNKCEYKLASEFIDDIELMFSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLHV TPSNVDQV Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Product Properties

• Molecular Weight: 42
• NCBI: 013448
• UniProt: Q9NRL2
• Purity: Highly Purified (~90%)
• Form: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 0.04% Tween 20, 20% glycerol.