BAZ2B, Recombinant, Human, aa2054-2168, His-Tag (Bromodomain Adjacent to Zinc Finger Domain 2B)

Product Overview

• Article Name: BAZ2B, Recombinant, Human, aa2054-2168, His-Tag (Bromodomain Adjacent to Zinc Finger Domain 2B)
• Biozol Catalog Number: USB-298333
• Supplier Catalog Number: 298333
• Alternative Catalog Number: USB-298333-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

BAZ2B (Bromodomain Adjacent To Zinc Finger Domain, 2B) is a Protein Coding gene. Source: Recombinant protein corresponding to aa2054-2168 from human BAZ2B, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~14.3kD AA Sequence: MHHHHHHSVKKPKRDDSKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKVIKKP MDFSTIREKLSSGQYPNLETFALDVRLVFDNCETFNEDDSDIGRAGHNMRKYFEKKWT DTFKVS Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Product Properties

• Molecular Weight: 14.3
• NCBI: 013450
• UniProt: Q9UIF8
• Purity: Purified (~84%)
• Form: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 0.04% Tween 20, 20% glycerol.