BRD2 (BD1+BD2), Recombinant, Human, aa65-459, His-Tag (Bromodomain Containing 2, RING3, RNF3)

Product Overview

• Article Name: BRD2 (BD1+BD2), Recombinant, Human, aa65-459, His-Tag (Bromodomain Containing 2, RING3, RNF3)
• Biozol Catalog Number: USB-298345
• Supplier Catalog Number: 298345
• Alternative Catalog Number: USB-298345-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

This gene encodes a transcriptional regulator that belongs to the BET (bromodomains and extra terminal domain) family of proteins. This protein associates with transcription complexes and with acetylated chromatin during mitosis, and it selectively binds to the acetylated lysine-12 residue of histone H4 via its two bromodomains. The gene maps to the major histocompatability complex (MHC) class II region on chromosome 6p21.3, but sequence comparison suggests that the protein is not involved in the immune response. This gene has been implicated in juvenile myoclonic epilepsy, a common form of epilepsy that becomes apparent in adolescence. Multiple alternatively spliced variants have been described for this gene. [provided by RefSeq, Dec 2010]. Source: Recombinant protein corresponding to aa65-459 from human Bromodomain containing 2, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~45kD AA Sequence: MHHHHHHEVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYH KIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQ KVASMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPT TVLNIPHPSVISSPLLKSLHSAGPPLLAVTAAPPAQPLAKKKGVKRKADTTTPTPTAILAPG SPASPPGSLEPKAARLPPMRRESGRPIKPPRKDLPDSQQQHQSSKKGKLSEQLKHCNGI LKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFA ADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPDEPLE Applications: Suitable for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. Storing diluted protein is not recommended, if necessary, use carrier protein (BSA 0.1-0.5%). Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Product Properties

• Molecular Weight: 45
• NCBI: 005104
• UniProt: P25440
• Purity: Purified (~90%)
• Form: Supplied as a liquid in 45mM Tris-HCl, pH 8.0, 124mM sodium chloride, 2.4mM KCl, 10% glycerol.