BRD3 (BD1+BD2), Recombinant, Human, aa29-471, His-Tag (Bromodomain Containing 3, RING3L)

Product Overview

• Article Name: BRD3 (BD1+BD2), Recombinant, Human, aa29-471, His-Tag (Bromodomain Containing 3, RING3L)
• Biozol Catalog Number: USB-298353
• Supplier Catalog Number: 298353
• Alternative Catalog Number: USB-298353-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

This gene was identified based on its homology to the gene encoding the RING3 protein, a serine/threonine kinase. The gene localizes to 9q34, a region which contains several major histocompatibility complex (MHC) genes. The function of the encoded protein is not known. [provided by RefSeq, Jul 2008]. Source: Recombinant protein corresponding to aa29-471 from human Bromodomain containing 3, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~44.2kD AA Sequence: MHHHHHHPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIK NPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQK VAQMPQEEVELLPPAPKGKGRKPAAGAQSAGTQQVAAVSSVSPATPFQSVPPTVSQ TPVIAATPVPTITANVTSVPVPPAAAPPPPATPIVPVVPPTPPVVKKKGVKRKADTTTPT TSAITASRSESPPPLSDPKQAKVVARRESGGRPIKPPKKDLEDGEVPQHAGKKGKLS EHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMD GREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPD Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Product Properties

• Molecular Weight: 44.2
• NCBI: 007371
• UniProt: Q15059
• Purity: Purified (~37%)
• Form: Supplied as a liquid in 40mM HEPES, pH 7.2, 290mM sodium chloride, 20% glycerol.