BRD4 (BD1), Recombinant, Human, aa49-170, GST-tag (Bromodomain Containing 4, HUNK1, MCAP)

Catalog Number: USB-298359
Article Name: BRD4 (BD1), Recombinant, Human, aa49-170, GST-tag (Bromodomain Containing 4, HUNK1, MCAP)
Biozol Catalog Number: USB-298359
Supplier Catalog Number: 298359
Alternative Catalog Number: USB-298359-100
Manufacturer: US Biological
Category: Molekularbiologie
The protein encoded by this gene is homologous to the murine protein MCAP, which associates with chromosomes during mitosis, and to the human RING3 protein, a serine/threonine kinase. Each of these proteins contains two bromodomains, a conserved sequence motif which may be involved in chromatin targeting. This gene has been implicated as the chromosome 19 target of translocation t(15,19)(q13,p13.1), which defines an upper respiratory tract carcinoma in young people. Two alternatively spliced transcript variants have been described. [provided by RefSeq, Jul 2008]. Source: Recombinant protein corresponding to aa49-170 from human Bromodomain containing 4, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.4kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYID GDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVD FLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFK KRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSETSNPNKP KRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRL ENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETE Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight: 41.4
NCBI: 058243
UniProt: O60885
Purity: Highly Purified (~95%)
Form: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 20% glycerol.