BRD9, Recombinant, Human, aa135-242, GST-tag (Bromodomain Containing 9)

Product Overview

• Article Name: BRD9, Recombinant, Human, aa135-242, GST-tag (Bromodomain Containing 9)
• Biozol Catalog Number: USB-298373
• Supplier Catalog Number: 298373
• Alternative Catalog Number: USB-298373-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Recombinant protein corresponding to aa135-242 from human Bromodomain containing 9, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~39kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYID GDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDF LSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKK RIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSENESTPIQQLL EHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADF KLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQAA Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Product Properties

• Molecular Weight: 39
• NCBI: 023924
• UniProt: Q9H8M2
• Purity: Highly Purified (~95%)
• Form: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 20% glycerol.