BRDT (BD2), Recombinant, Human, aa257-382, GST-tag (Bromodomain Testis-Specific Protein, BRD6, CT9)
Catalog Number:
USB-298378
- Images (0)
| Article Name: | BRDT (BD2), Recombinant, Human, aa257-382, GST-tag (Bromodomain Testis-Specific Protein, BRD6, CT9) |
| Biozol Catalog Number: | USB-298378 |
| Supplier Catalog Number: | 298378 |
| Alternative Catalog Number: | USB-298378-100 |
| Manufacturer: | US Biological |
| Category: | Molekularbiologie |
| BRDT is similar to the RING3 protein family. It possesses 2 bromodomain motifs and a PEST sequence (a cluster of proline, glutamic acid, serine, and threonine residues), characteristic of proteins that undergo rapid intracellular degradation. The bromodomain is found in proteins that regulate transcription. Several transcript variants encoding multiple isoforms have been found for this gene. [provided by RefSeq, Jun 2011]. Source: Recombinant protein corresponding to human Bromodomain testis-specific protein, aa257-382 from bromodomain 2, fused to N-terminal GST-tag, expressed in E. coli. Molecular Weight: ~41.7kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSSQQQ YNVVKTVKVTEQLRHCSEILKEMLAKKHFSYAWPFYNPVDVNALGLHNYYDVVKNPM DLGTIKEKMDNQEYKDAYKFAADVRLMFMNCYKYNPPDHEVVTMARMLQDVFETHF SKIPIEPVE Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. |
Product Guarantee and Expert Support
