BRPF3, Recombinant, Human, aa576-701, GST-tag (Bromodomain and PHD Finger Containing 3)

Product Overview

• Article Name: BRPF3, Recombinant, Human, aa576-701, GST-tag (Bromodomain and PHD Finger Containing 3)
• Biozol Catalog Number: USB-298384
• Supplier Catalog Number: 298384
• Alternative Catalog Number: USB-298384-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to a single bromodomain, aa576-701, from human Bromodomain and PHD finger containing 3, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.2kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSQVKV QQAAMELELMPFNVLLRTTLDLLQEKDPAHIFAEPVNLSEVPDYLEFISKPMDFSTMR RKLESHLYRTLEEFEEDFNLIVTNCMKYNAKDTIFHRAAVRLRDLGGAILRHARRQAE NIG Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Product Properties

• Molecular Weight: 41.2
• NCBI: 015695
• UniProt: Q9ULD4
• Purity: Purified (~80%)
• Form: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 20% glycerol.