CD155, Recombinant, Human, aa27-343, His-Tag (Poliovirus Receptor and Nectin-Like Protein 5)

Product Overview

• Article Name: CD155, Recombinant, Human, aa27-343, His-Tag (Poliovirus Receptor and Nectin-Like Protein 5)
• Biozol Catalog Number: USB-298390
• Supplier Catalog Number: 298390
• Alternative Catalog Number: USB-298390-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

The protein encoded by this gene is a transmembrane glycoprotein belonging to the immunoglobulin superfamily. The external domain mediates cell attachment to the extracellular matrix molecule vitronectin, while its intracellular domain interacts with the dynein light chain Tctex-1/DYNLT1. The gene is specific to the primate lineage, and serves as a cellular receptor for poliovirus in the first step of poliovirus replication. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]. Source: Recombinant protein corresponding to aa27-343 from human CD155, fused to His-tag at C-terminal, expressed in HEK293 cell expression system. Molecular Weight: ~35kD, protein runs at a higher MW by SDS-PAGE due to glycosylation Endotoxin: <1EU/ug AA Sequence: GDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQ GPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWL RVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGF LSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDN NWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLI CNVTNALGARQAELTVQVKEGPPSEHSGMSRNHHHHHH Applications: Suitable for use in studying protein binding and for screening small molecules and antibodies. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Product Properties

• Molecular Weight: 35
• NCBI: 006505
• UniProt: P15151
• Purity: Highly Purified (~90%)
• Form: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 20% glycerol.