CD47, Fc, Recombinant, Human, aa19-139 (Leukocyte Surface Antigen CD47, Rh-Related Antigen, Integrin-Associated Protein, Antigenic Surface Determinant Protein OA3, Antigen Identified by Monoclonal Antibody 1D8, IAP, MER6)

Catalog Number: USB-298393
Article Name: CD47, Fc, Recombinant, Human, aa19-139 (Leukocyte Surface Antigen CD47, Rh-Related Antigen, Integrin-Associated Protein, Antigenic Surface Determinant Protein OA3, Antigen Identified by Monoclonal Antibody 1D8, IAP, MER6)
Biozol Catalog Number: USB-298393
Supplier Catalog Number: 298393
Alternative Catalog Number: USB-298393-100
Manufacturer: US Biological
Category: Molekularbiologie
This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2010]. Source: Recombinant Fc fusion protein corresponding to aa19-139 from human CD47 at C-terminal, expressed in a HEK293 cell expression system. Molecular Weight: ~40kD, runs at a higher MW by SDS-PAGE due to glycosylation AA Sequence: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKST VPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVS WFSPIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCK VSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWE SNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQK SLSLSPGK Applications: Suitable for use in the study of protein binding, screening small molecules and antibodies. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight: 40
NCBI: 001777
UniProt: Q08772
Purity: Purified (~90%)
Form: Supplied as a liquid in 40mM Tris, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 20% glycerol.