CDY1, Recombinant, Human, aa2-90, GST-tag (Chromodomain Protein Y-Linked 1, CDY, Testis-Specific Chromodomain Protein Y1)
Biozol Catalog Number:
USB-298396
Supplier Catalog Number:
298396
Alternative Catalog Number:
USB-298396-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Chromodomain proteins are components of heterochromatin-like complexes and can act as gene repressors. CDY1 contains a chromodomain and a histone acetyltransferase catalytic domain. CDY1 has histone acetyltransferase activity, with a preference for histone H4. This protein is localized to the nucleus of late spermatids where histone hyperacetylation takes place. Histone hyperacetylation is thought to facilitate the transition in which protamines replace histones as the major DNA-packaging protein. Source: Recombinant protein corresponding to aa2-90 from human chromodomain protein Y-linked 1, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~37.6kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSASQEF EVEAIVDKRQDKNGNTQYLVRWKGYDKQDDTWEPEQHLMNCEKCVHDFNRRQTEK QKKLTWTTTSRIFSNNARRRTSRSTKANY Applications: Suitable for use in protein binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.