CECR2, Recombinant, Human, aa430-543, GST-tag (Cat Eye Syndrome Chromosome Region, Candidate 2)

Catalog Number: USB-298399
Article Name: CECR2, Recombinant, Human, aa430-543, GST-tag (Cat Eye Syndrome Chromosome Region, Candidate 2)
Biozol Catalog Number: USB-298399
Supplier Catalog Number: 298399
Alternative Catalog Number: USB-298399-100
Manufacturer: US Biological
Category: Molekularbiologie
CECR2 is a bromodomain-containing protein that is part of the CERF (CECR2-containing remodeling factor) complex, which facilitates the perturbation of chromatin structure in an ATP-dependent manner. May be involved through its interaction with RPPRC in the integration of cytoskeletal network with vesicular trafficking, nucleocytosolic shuttling, transcription, chromosome remodeling and cytokinesis. Source: Recombinant protein corresponding to aa430-543 from human bromodomain CECR2, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.3kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSTKDLF ELDDDFTAMYKVLDVVKAHKDSWPFLEPVDESYAPNYYQIIKAPMDISSMEKKLNGG LYCTKEEFVNDMKTMFRNCRKYNGESSEYTKMSDNLERCFHRAMMKHFPGED Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight: 40.3
NCBI: 031413
UniProt: Q9BXF3
Purity: Highly Purified (~90%)
Form: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 0.04% Tween 20, 20% glycerol.