GCN5, Recombinant, Human, aa727-837, His-Tag (Histone Acetyltransferase KAT2A)

Product Overview

• Article Name: GCN5, Recombinant, Human, aa727-837, His-Tag (Histone Acetyltransferase KAT2A)
• Biozol Catalog Number: USB-298410
• Supplier Catalog Number: 298410
• Alternative Catalog Number: USB-298410-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

KAT2A, or GCN5, is a histone acetyltransferase (HAT) that functions primarily as a transcriptional activator. It also functions as a repressor of NF-kappa-B (see MIM 164011) by promoting ubiquitination of the NF-kappa-B subunit RELA (MIM 164014) in a HAT-independent manner (Mao et al., 2009 [PubMed 19339690]).[supplied by OMIM, Sep 2009]. Source: Recombinant protein corresponding to aa727-837 from human GCN5, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~14.1kD AA Sequence: MHHHHHHLKDPDQLYTTLKNLLAQIKSHPSAW PFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSR YYVTRKLFVADLQRVIANCREYNPPDSEYCRCA SALEKFFYFKLKEGGLIDK Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Product Properties

• Molecular Weight: 14.1
• NCBI: 021078
• UniProt: Q92830
• Purity: Highly Purified (~99%)
• Form: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, <0.01% Tween 20, 20% glycerol.