HSP90a (C-terminal), Recombinant, Human, aa535-732, His-Tag (Heat Shock Protein 90 alpha, HSP90alpha, HSP90 alpha) (Biotin)

Product Overview

• Article Name: HSP90a (C-terminal), Recombinant, Human, aa535-732, His-Tag (Heat Shock Protein 90 alpha, HSP90alpha, HSP90 alpha) (Biotin)
• Biozol Catalog Number: USB-298413
• Supplier Catalog Number: 298413
• Alternative Catalog Number: USB-298413-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

The protein encoded by this gene is an inducible molecular chaperone that functions as a homodimer. The encoded protein aids in the proper folding of specific target proteins by use of an ATPase activity that is modulated by co-chaperones. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]. Source: Recombinant protein corresponding to aa535-732 from human Heat Shock Protein 90 alpha, fused to His-tag and Avi-tag at N-terminal, expressed in E. coli. Molecular Weight: ~25kD AA Sequence: MHHHHHHGGGLNDIFEAQKIEWHEEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTK FENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTM GYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTH ANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTSRMEEVD Applications: Suitable for use in the study of enzyme kinetics, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Product Properties

• Molecular Weight: 25
• NCBI: 005348
• UniProt: P07900
• Purity: Highly Purified (~90%)
• Form: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 0.04% Tween 20, 20% glycerol. Labeled with Biotin.