L3MBTL1, Recombinant, Human, aa191-530, His-Tag (Lethal(3) Malignant Brain Tumor-Like Protein 1)

Product Overview

• Article Name: L3MBTL1, Recombinant, Human, aa191-530, His-Tag (Lethal(3) Malignant Brain Tumor-Like Protein 1)
• Biozol Catalog Number: USB-298422
• Supplier Catalog Number: 298422
• Alternative Catalog Number: USB-298422-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Polycomb group (PcG) protein that specifically recognizes and binds mono- and dimethyl-lysine residues on target proteins, therey acting as a reader of a network of post-translational modifications. PcG proteins maintain the transcriptionally repressive state of genes: acts as a chromatin compaction factor by recognizing and binding mono- and dimethylated histone H1b/HIST1H1E at Lys26 (H1bK26me1 and H1bK26me2) and histone H4 at Lys-20 (H4K20me1 and H4K20me2), leading to condense chromatin and repress transcription. Recognizes and binds p53/TP53 monomethylated at Lys-382, leading to repress p53/TP53-target genes. Also recognizes and binds RB1/RB monomethylated at Lys-860. Participates in the ETV6-mediated repression. Probably plays a role in cell proliferation. Overexpression induces multinucleated cells, suggesting that it is required to accomplish normal mitosis. Source: Recombinant protein corresponding to aa191-530 from human L3MBTL1, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.6kD AA Sequence: MHHHHHHEWSSSQPATGEKKECWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGF KLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGW FEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKL EAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQG KPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNP ALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGPR EPSSASPGG Applications: Suitable for use in the study of Polycomb group (PcG) proteins, protein binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Product Properties

• Molecular Weight: 39.6
• NCBI: 015478
• UniProt: Q9Y468
• Purity: Highly Purified (~95%)
• Form: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 20% glycerol.