L3MBTL2, Recombinant, Human, aa178-625, His-Tag (Lethal(3) Malignant Brain Tumor-Like Protein 2)

Product Overview

• Article Name: L3MBTL2, Recombinant, Human, aa178-625, His-Tag (Lethal(3) Malignant Brain Tumor-Like Protein 2)
• Biozol Catalog Number: USB-298423
• Supplier Catalog Number: 298423
• Alternative Catalog Number: USB-298423-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Putative Polycomb group (PcG) protein. PcG proteins maintain the transcriptionally repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility. Its association with a chromatin-remodeling complex suggests that it may contribute to prevent expression of genes that trigger the cell into mitosis. Binds to monomethylated and dimethylated Lys-20 on histone H4. Binds histone H3 peptides that are monomethylated or dimethylated on Lys-4, Lys-9 or Lys-27. Source: Recombinant protein corresponding to aa178-625 from human L3MBTL2, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~52.2kD AA Sequence: MHHHHHHGFDWGKFLKDHSYKAAPVSCFKHVPLYDQWEDVMKGMKVEVLNSDAVL PSRVYWIASVIQTAGYRVLLRYEGFENDASHDFWCNLGTVDVHPIGWCAINSKILVPP RTIHAKFTDWKGYLMKRLVGSRTLPVDFHIKMVESMKYPFRQGMRLEVVDKSQVSRT RMAVVDTVIGGRLRLLYEDGDSDDDFWCHMWSPLIHPVGWSRRVGHGIKMSERRSD MAHHPTFRKIYCDAVPYLFKKVRAVYTEGGWFEEGMKLEAIDPLNLGNICVATVCKVL LDGYLMICVDGGPSTDGLDWFCYHASSHAIFPATFCQKNDIELTPPKGYEAQTFNWE NYLEKTKSKAAPSRLFNMDCPNHGFKVGMKLEAVDLMEPRLICVATVKRVVHRLLSI HFDGWDSEYDQWVDCESPDIYPVGWCELTGYQLQPPVAAEPATPLKAKEATKKKKK Q Applications: Suitable for use in the study of Polycomb group (PcG) proteins, protein binding studies, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Product Properties

• Molecular Weight: 52.2
• NCBI: 031488
• UniProt: Q969R5
• Purity: Highly Purified (~90%)
• Form: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 0.04% Tween 20, 20% glycerol.