L3MBTL3, Recombinant, Human, aa229-547, GST-tag (Lethal(3) Malignant Brain Tumor-Like Protein 3)

Catalog Number: USB-298424
Article Name: L3MBTL3, Recombinant, Human, aa229-547, GST-tag (Lethal(3) Malignant Brain Tumor-Like Protein 3)
Biozol Catalog Number: USB-298424
Supplier Catalog Number: 298424
Alternative Catalog Number: USB-298424-100
Manufacturer: US Biological
Category: Molekularbiologie
PcG proteins maintain the transcriptionally repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility. Its association with a chromatin-remodeling complex suggests that it may contribute to prevent expression of genes that trigger the cell into mitosis. Source: Recombinant protein corresponding to aa229-547 from human L3MBTL3, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~63.6kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSKKAW CWASYLEEEKAVAVPAKLFKEHQSFPYNKNGFKVGMKLEGVDPEHQSVYCVLTVAE VCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQT YLKTCKAQAAPKSLFENQNITVIPSGFRVGMKLEAVDKKNPSFICVATVTDMVDNRFL VHFDNWDESYDYWCEASSPHIHPVGWCKEHRRTLITPPGYPNVKHFSWDKYLEETN SLPAPARAFKVKPPHGFQKKMKLEVVDKRNPMFIRVATVADTDDHRVKVHFDGWNN CYDYWIDADSPDIHPVGWCSKTGHPLQPPLSPL Applications: Suitable for use in the study of Polycomb group (PcG) proteins, protein binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight: 63.6
NCBI: 032438
UniProt: Q96JM7
Purity: Highly Purified (~91%)
Form: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 1.8mM glutathione, 0.007% Tween 20, 20% glycerol.