PHIP (BD1), Recombinant, Human, aa1146-1287, GST-tag (Bromodomain Pleckstrin Homology Domain Interacting Protein, IRS-1 PH Domain-Binding Protein, WDR11, BRWD2)
Catalog Number:
USB-298446
- Images (0)
| Article Name: | PHIP (BD1), Recombinant, Human, aa1146-1287, GST-tag (Bromodomain Pleckstrin Homology Domain Interacting Protein, IRS-1 PH Domain-Binding Protein, WDR11, BRWD2) |
| Biozol Catalog Number: | USB-298446 |
| Supplier Catalog Number: | 298446 |
| Alternative Catalog Number: | USB-298446-100 |
| Manufacturer: | US Biological |
| Category: | Molekularbiologie |
| PHIP is a bromodomain-containing protein that binds the pleckstrin homology (PH) domain of insulin receptor substrate-1 (IRS1), modulates insulin signaling, and plays a role in pancreatic beta cell growth and survival. It stimulates cell proliferation through regulation of cyclin transcription and has an anti-apoptotic activity through AKT1 phosphorylation and activation. Source: Recombinant protein corresponding to bromodomain 1, aa1146-1287, from human PHIP, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~43kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSSLIYK PLDGEWGTNPRDEECERIVAGINQLMTLDIASAFVAPVDLQAYPMYCTVVAYPTDLST IKQRLENRFYRRVSSLMWEVRYIEHNTRTFNEPGSPIVKSAKFVTDLLLHFIKDQTCYNI IPLYNSMKKKVLSDSEDEE Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. |
Product Guarantee and Expert Support
