PHIP is a bromodomain-containing protein that binds the pleckstrin homology (PH) domain of insulin receptor substrate-1 (IRS1), modulates insulin signaling, and plays a role in pancreatic beta cell growth and survival. It stimulates cell proliferation through regulation of cyclin transcription and has an anti-apoptotic activity through AKT1 phosphorylation and activation. Source: Recombinant protein corresponding to bromodomain 1, aa1146-1287, from human PHIP, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~17kD AA Sequence: MHHHHHHSLIYKPLDGEWGTNPRDEECERIVAGINQLMTLDIASAFVAPVDLQAYPMY CTVVAYPTDLSTIKQRLENRFYRRVSSLMWEVRYIEHNTRTFNEPGSPIVKSAKFVTDL LLHFIKDQTCYNIIPLYNSMKKKVLSDSEDEE Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.