TAF1L, Recombinant, Human, aa1517-1649, GST-tag (TAF1 RNA Polymerase II, TAT Box Binding Protein (TBP)-Associated Factor)

Product Overview

• Article Name: TAF1L, Recombinant, Human, aa1517-1649, GST-tag (TAF1 RNA Polymerase II, TAT Box Binding Protein (TBP)-Associated Factor)
• Biozol Catalog Number: USB-298478
• Supplier Catalog Number: 298478
• Alternative Catalog Number: USB-298478-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

This locus is intronless, and apparently arose in the primate lineage from retrotransposition of the transcript from the multi-exon TAF1 locus on the X chromosome. The gene is expressed in male germ cells, and the product has been shown to function interchangeably with the TAF1 product. [provided by RefSeq, Aug 2009]. Source: Recombinant protein corresponding to aa1517-1649 from human TAF1L, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.3kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSLLDDD DQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKMIVNPVDLETIRKNISKHK YQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNICYQTITEYDEHLTQLEKDICTA KEAALEEAE Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Product Properties

• Molecular Weight: 42.3
• NCBI: 153809
• UniProt: Q8IZX4
• Purity: Highly Purified (~99%)
• Form: Supplied as a liquid in 45mM Tris-HCl, pH 8.0, 124mM sodium chloride, 2.4mM KCl, 10% glycerol.