TRIM28, Recombinant, Human, aa685-815, GST-tag (Tripartite Motif Containing 28, KRIP-1, KAP-1, TIF1-Beta, RNF96)

Catalog Number: USB-298486
Article Name: TRIM28, Recombinant, Human, aa685-815, GST-tag (Tripartite Motif Containing 28, KRIP-1, KAP-1, TIF1-Beta, RNF96)
Biozol Catalog Number: USB-298486
Supplier Catalog Number: 298486
Alternative Catalog Number: USB-298486-100
Manufacturer: US Biological
Category: Molekularbiologie
The protein encoded by this gene mediates transcriptional control by interaction with the Kruppel-associated box repression domain found in many transcription factors. The protein localizes to the nucleus and is thought to associate with specific chromatin regions. The protein is a member of the tripartite motif family. This tripartite motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. [provided by RefSeq, Jul 2008]. Source: Recombinant protein corresponding to aa685-815 from human bromodomain tripartite motif containing 28, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~41kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSDGAD STGVVAKLSPANQRKCERVLLALFCHEPCRPLHQLATDSTFSLDQPGGTLDLTLIRAR LQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKADVQSIIGLQRFFETRMNEAFGDT KFSAVLVEPPPM Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight: 41
NCBI: 005762
UniProt: Q13263
Purity: Highly Purified (~90%)
Form: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 0.04% Tween 20, 20% glycerol.