ZMYND11, Recombinant, Human, aa150-270, GST-tag (Zinc Finger MYND-Type Containing 11, BRAM1, BS69)

Product Overview

• Article Name: ZMYND11, Recombinant, Human, aa150-270, GST-tag (Zinc Finger MYND-Type Containing 11, BRAM1, BS69)
• Biozol Catalog Number: USB-298495
• Supplier Catalog Number: 298495
• Alternative Catalog Number: USB-298495-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

The protein encoded by this gene was first identified by its ability to bind the adenovirus E1A protein. The protein localizes to the nucleus. It functions as a transcriptional repressor, and expression of E1A inhibits this repression. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]. Source: Recombinant protein corresponding to aa150-270 from human bromodomain ZMYND11, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~41kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYID GDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDF LSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKK RIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSKKNTNKQEM GTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFK ADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Product Properties

• Molecular Weight: 41
• NCBI: 006624
• UniProt: Q15326
• Purity: Purified (~80%)
• Form: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 0.04% Tween 20, 20% glycerol.