ALDH2, NT (Acetaldehyde Dehydrogenase 2, Aldehyde Dehydrogenase 2 Family (Mitochondrial), Aldehyde Dehydrogenase 2 Family, Aldehyde Dehydrogenase Mitochondrial, Aldehyde Dehydrogenase, Mitochondrial, ALDH 2, ALDH Class 2, ALDH E2,

Catalog Number: USB-303108
Article Name: ALDH2, NT (Acetaldehyde Dehydrogenase 2, Aldehyde Dehydrogenase 2 Family (Mitochondrial), Aldehyde Dehydrogenase 2 Family, Aldehyde Dehydrogenase Mitochondrial, Aldehyde Dehydrogenase, Mitochondrial, ALDH 2, ALDH Class 2, ALDH E2,
Biozol Catalog Number: USB-303108
Supplier Catalog Number: 303108
Alternative Catalog Number: USB-303108-100
Manufacturer: US Biological
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: Synthetic peptide corresponding to aa18-48, SAAATQAVPAPNQQPEVFCNQIFINNEWHDA, from human ALDH2 at N-terminus, different from the related mouse sequence by 2aa, and from the related rat sequence by 1aa.
ALDH2 (Aldehyde Dehydrogenase 2 Family) is a human gene. The enzyme encoded by this gene belongs to the aldehyde dehydrogenase family of enzymes that catalyze the chemical transformation from acetaldehyde to acetic acid. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Hsu et al. (1985) assigned the ALDH2 locus to chromosome 12 by means of a cDNA probe and Southern blot analysis of somatic cell hybrids. Using an unbiased proteomic search, Chen et al. (2008) identified mitochondrial ALDH2 as an enzyme whose activation correlated with reduced ischemic heart damage in rodent models. A high-throughput screen identified a small molecule activator of ALDH2, which they called Alda-1, that, when administered to rats before an ischemic event, reduced infarct size by 60%, most likely through its inhibitory effect on the formation of cytotoxic aldehydes. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 0.1-0.5ug/ml Immunohistochemistry (paraffin): 0.5-1ug/ml, boiling the paraffin sections in 10mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections. Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
UniProt: P05091
Purity: Purified by immunoaffinity chromatography.
Form: Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile dH2O.