Parathyroid Hormone, Active, Recombinant, Human, aa32-115

Catalog Number: USB-348193
Article Name: Parathyroid Hormone, Active, Recombinant, Human, aa32-115
Biozol Catalog Number: USB-348193
Supplier Catalog Number: 348193
Alternative Catalog Number: USB-348193-100,USB-348193-500
Manufacturer: US Biological
Category: Molekularbiologie
PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells. Full length recombinant protein corresponding to aa32-115 from human Parathyroid hormone, expressed in E. coli. Swiss/UniProt Accession: P01270 Molecular Weight: ~9kD Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by its ability to induce cAMP accumulation in murine MC3T3E1 cells is less than 50ng/ml, corresponding to a specific activity of >2x104eIU/mg. Amino Acid Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 9.4
UniProt: P01270
Purity: 97% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Form: Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.