HSP90AB1, CT (Hsp90 beta, Heat shock protein HSP 90-beta, Heat shock protein 90kD alpha (cytosolic) class B member 1, Heat shock 84kD), Rabbit

Catalog Number: USB-350666
Article Name: HSP90AB1, CT (Hsp90 beta, Heat shock protein HSP 90-beta, Heat shock protein 90kD alpha (cytosolic) class B member 1, Heat shock 84kD), Rabbit
Biozol Catalog Number: USB-350666
Supplier Catalog Number: 350666
Alternative Catalog Number: USB-350666-100
Manufacturer: US Biological
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: Synthetic peptide corresponding to aa449-481, RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK, of human Hsp90 beta at C-terminal.
Heat shock protein HSP 90-beta, also called HSP90beta, is a protein that in humans is encoded by the HSP90AB1 gene. It is mapped to chromosome 6p21.1. This gene encodes a member of the heat shock protein 90 family, these proteins are involved in signal transduction, protein folding and degradation and morphological evolution. And this gene is thought to play a role in gastric apoptosis and inflammation. Alternative splicing results in multiple transcript variants. Pseudogenes have been identified on multiple chromosomes. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 0.1-0.5ug/ml Immunohistochemistry (paraffin): 0.5-1ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
UniProt: P08238
Purity: Purified by immunoaffinity chromatography.
Form: Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.