MAOA, CT (Amine oxidase [flavin-containing] A, Monoamine oxidase A), Rabbit

Catalog Number: USB-350729
Article Name: MAOA, CT (Amine oxidase [flavin-containing] A, Monoamine oxidase A), Rabbit
Biozol Catalog Number: USB-350729
Supplier Catalog Number: 350729
Alternative Catalog Number: USB-350729-100
Manufacturer: US Biological
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: Synthetic peptide corresponding to aa457-493, REVLNGLGKVTEKDIWVQEPESKDVPAVEITHTF- WER, of human MAOV at C-terminal.
MAOA(Monoamine oxidase A), also known as Amine Oxidase (Flavin-containing) A, is an enzyme that in humans is encoded by the MAO-A gene. MAOA is an isozyme of monoamine oxidase which is also mapped on Xp11.3. MAOA degrades amine neurotransmitters, such as dopamine, norepinephrine, and serotonin. The protein localizes to the outer mitochondrial membrane. Mutation in MAOA results in monoamine oxidase deficiency, or Brunner syndrome. In humans, there is a 30-base repeat sequence repeated in one of several different numbers of times in the promoter region of the gene coding for MAOA. MAO-A levels in the brain as measured using positron emission tomography are elevated by an average of 34% in patients with major depressive disorder. Inhibition of MAOA prevented apoptosis, and serum starvation of cortical brain cells from Maoa-deficient mice resulted in reduced apoptosis compared with wildtype mice. Applications: Suitable for use in Western Blot, Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 0.1-0.5ug/ml Immunohistochemistry (paraffin): 0.5-1ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
UniProt: P21397
Purity: Purified by immunoaffinity chromatography.
Form: Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.