Munc18-1 (Syntaxin-Binding Protein 1, Munc 18a, MUNC18 1, MUNC-18 1, N-Sec1, Protein Unc-18 Homolog 1, Protein Unc-18 Homolog A, STXB1, STXBP 1, STXBP1, Syntaxin-Binding Protein 1, Unc 18 Homolog, Unc 18A, UNC18, Unc18 1, Unc18-1,
Biozol Catalog Number:
USB-353279
Supplier Catalog Number:
353279
Alternative Catalog Number:
USB-353279-100
Manufacturer:
US Biological
Host:
Rabbit
Category:
Antikörper
Application:
IHC, WB
Immunogen:
Synthetic peptide corresponding to aa184-216, KEYPAVRYRGEYKDNALLAQLIQDKLDAYKADD, of human Munc18-1 at N-terminal.
Syntaxin-binding protein 1, also known as Munc18-1, is a protein that in humans is encoded by the STXBP1 gene. By fluorescence in situ hybridization, the STXBP1 gene is mapped to chromosome 9q34.1. This gene encodes a syntaxin-binding protein. The encoded protein appears to play a role in release of neurotransmitters via regulation of syntaxin, a transmembrane attachment protein receptor. Mutations in this gene have been associated with infantile epileptic encephalopathy-4. Alternatively spliced transcript variants have been described. Applications: Suitable for use in Western Blot, Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 0.1-0.5ug/ml Immunohistochemistry (paraffin): 0.5-1ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized powder may be stored at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder in 5mg BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05mg sodium azide. Reconstitute with 200ul sterile dH2O to ~0.5mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted