TGFBR1 (Transforming Growth Factor, Beta Receptor 1, AAT5, ALK 5, ALK5, ALK-5, MSSE, SKR 4, SKR4, TbetaR I, TbetaR-I, TGF B Receptor I, TGF beta Receptor I, TGF beta Receptor Type 1, TGF beta Receptor Type I, TGF beta Type I Recep
TGFBR1 (Transforming Growth Factor, Beta Receptor 1, AAT5, ALK 5, ALK5, ALK-5, MSSE, SKR 4, SKR4, TbetaR I, TbetaR-I, TGF B Receptor I, TGF beta Receptor I, TGF beta Receptor Type 1, TGF beta Receptor Type I, TGF beta Type I Recep
TGFBR1 (Transforming Growth Factor, Beta Receptor 1, AAT5, ALK 5, ALK5, ALK-5, MSSE, SKR 4, SKR4, TbetaR I, TbetaR-I, TGF B Receptor I, TGF beta Receptor I, TGF beta Receptor Type 1, TGF beta Receptor Type I, TGF beta Type I Recep
Biozol Catalog Number:
USB-353308
Supplier Catalog Number:
353308
Alternative Catalog Number:
USB-353308-100
Manufacturer:
US Biological
Host:
Rabbit
Category:
Antikörper
Application:
WB
Immunogen:
Synthetic peptide corresponding to aa149-186, HNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTT, of human TGFBR1 at N-terminal.
Transforming growth factor, beta receptor I, is a TGF beta receptor. TGFBR1 is its human gene. The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). TGFB1 regulates cell cycle progression by a unique signaling mechanism that involves its binding to TGFBR2 and activation of TGFBR1. Both are transmembrane serine/threonine receptor kinases. The TGFBR1 receptor may be inactivated in many of the cases of human tumor cells refractory to TGFB-mediated cell cycle arrest. Vellucci and Reiss (1997) reported that the TGFBR1 gene is ~31kb long and contains 9 exons. The organization of the segment of the gene that encodes the C- terminal portion of the serine/threonine kinase domain appears to be highly conserved among members of the gene family. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 0.1-0.5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized powder may be stored at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder in 5mg BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05mg sodium azide. Reconstitute with 200ul sterile dH2O to ~0.5mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted