17kD Surface Antigen (omp), Strain ATCC VR-1363/YH, Rickettsia japonica, Recombinant, aa20-159, His-SUMO-Tag

Catalog Number: USB-367193
Article Name: 17kD Surface Antigen (omp), Strain ATCC VR-1363/YH, Rickettsia japonica, Recombinant, aa20-159, His-SUMO-Tag
Biozol Catalog Number: USB-367193
Supplier Catalog Number: 367193
Alternative Catalog Number: USB-367193-20,USB-367193-100,USB-367193-1
Manufacturer: US Biological
Category: Molekularbiologie
Rickettsia rickettsii is an obligate intracellular Gram-negative bacterium that causes Rocky Mountain spotted fever (RMSF), a serious life-threatening disease. RMSF was first found in the Snake River Valley of Idaho in 1896 and described by Edward E Maxey. Patients suffering from RMSF usually present fever, headache, myalgias, and rash, as well as a history of tick bite or contact. For serious R. rickettsii infection, patients will develop symptoms of acute lung edema, renal failure, and/or encephalitis due to wide spread vasculitis caused by rickettsial infection of endothelial cells lining the small blood vessels in these vital organs. Full-length recombinant protein corresponding to aa20-159 of Rickettsia japonica fused to 6X His-SUMO-Tag at N-terminal, expressed in E. coli. Swiss/UniProt Accession: Q52764. Molecular Weight: ~31.4kD Amino Acid Sequence: CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGTGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 27.5
UniProt: Q52764
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 10mM Tris-HCl, 1mM EDTA, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.