CD276 (B7 Homolog 3, CD276 Antigen, Costimulatory Molecule, B7H3, B7-H3, B7RP-2, 4Ig-B7-H3), Clone: [1A6], Mouse, Monoclonal

Catalog Number: USB-368009
Article Name: CD276 (B7 Homolog 3, CD276 Antigen, Costimulatory Molecule, B7H3, B7-H3, B7RP-2, 4Ig-B7-H3), Clone: [1A6], Mouse, Monoclonal
Biozol Catalog Number: USB-368009
Supplier Catalog Number: 368009
Alternative Catalog Number: USB-368009-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Immunogen: CD276 (AAH62581.1, aa237-358) partial recombinant protein with GST tag.
The protein encoded by this gene belongs to the immunoglobulin superfamily, and thought to participate in the regulation of T-cell-mediated immune response. Studies show that while the transcript of this gene is ubiquitously expressed in normal tissues and solid tumors, the protein is preferentially expressed only in tumor tissues. Additionally, it was observed that the 3 UTR of this transcript contains a target site for miR29 microRNA, and there is an inverse correlation between the expression of this protein and miR29 levels, suggesting regulation of expression of this gene product by miR29. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAA Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clonality: Monoclonal
Clone Designation: [1A6]
NCBI: 62581
UniProt: Q5ZPR3
Purity: Purified
Form: Supplied as a liquid in PBS, pH 7.4.