LTBR (Tumor necrosis factor receptor superfamily member 3, Lymphotoxin-beta receptor, Tumor necrosis factor C receptor, Tumor necrosis factor receptor 2-related protein, Tumor necrosis factor receptor type III, D12S370, LT-BETA-R,
Catalog Number:
USB-368227
- Images (0)
| Article Name: | LTBR (Tumor necrosis factor receptor superfamily member 3, Lymphotoxin-beta receptor, Tumor necrosis factor C receptor, Tumor necrosis factor receptor 2-related protein, Tumor necrosis factor receptor type III, D12S370, LT-BETA-R, |
| Biozol Catalog Number: | USB-368227 |
| Supplier Catalog Number: | 368227 |
| Alternative Catalog Number: | USB-368227-100 |
| Manufacturer: | US Biological |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | ELISA |
| Immunogen: | LTBR (NP_002333.1, aa37-225) partial recombinant protein with GST tag. |
| The protein encoded by this gene is a member of the tumor necrosis factor (TNF) family of receptors. It is expressed on the surface of most cell types, including cells of epithelial and myeloid lineages, but not on T and B lymphocytes. The protein specifically binds the lymphotoxin membrane form (a complex of lymphotoxin-alpha and lymphtoxin-beta). The encoded protein and its ligand play a role in the development and organization of lymphoid tissue and tranformed cells. Activation of the encoded protein can trigger apoptosis. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTM Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. |
Product Guarantee and Expert Support
