MAPK12 (Mitogen-activated Protein Kinase 12, MAP Kinase 12, ERK3, ERK6, P38GAMMA, PRKM12, SAPK-3, SAPK3), Clone: [2C1], Mouse, Monoclonal

Catalog Number: USB-368240
Article Name: MAPK12 (Mitogen-activated Protein Kinase 12, MAP Kinase 12, ERK3, ERK6, P38GAMMA, PRKM12, SAPK-3, SAPK3), Clone: [2C1], Mouse, Monoclonal
Biozol Catalog Number: USB-368240
Supplier Catalog Number: 368240
Alternative Catalog Number: USB-368240-200
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Immunogen: MAPK12 (AAH15741, aa251-367) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases. The protein encoded by this gene functions as a signal transducer during differentiation of myoblasts to myotubes. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clonality: Monoclonal
Clone Designation: [2C1]
NCBI: 15741
UniProt: P53778
Purity: Ascites
Form: Supplied as a liquid.