PDCD1LG2 (Programmed Cell Death 1 Ligand 2, B7DC, Btdc, CD273, PD-L2, PDCD1L2, PDL2), Clone: [4D6], Mouse, Monoclonal

Catalog Number: USB-368289
Article Name: PDCD1LG2 (Programmed Cell Death 1 Ligand 2, B7DC, Btdc, CD273, PD-L2, PDCD1L2, PDL2), Clone: [4D6], Mouse, Monoclonal
Biozol Catalog Number: USB-368289
Supplier Catalog Number: 368289
Alternative Catalog Number: USB-368289-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Immunogen: PDCD1LG2 (AAH74766.1, aa19-121) partial recombinant protein with GST tag.
Programmed cell death 1 ligand 2 (PD-L2, B7-DC, CD273) is a member of the B7 family of cell surface ligands that regulate T-cell activation and immune responses (1,2). PD-L2 binds the PD-1 transmembrane receptor and inhibits T-cell activation. PD-L2 was discovered following a search for novel B7 protein homologs and was later shown to be expressed by activated dendritic cells, macrophages, and T-cells (1,3). Similar in structure to related B7 family members, PD-L2 protein contains extracellular IgV and IgC2 domains, a transmembrane domain, and a short, cytoplasmic region. Research studies demonstrate that PD-L2 is expressed in several tumor types, including lung cancer, renal cell carcinoma, melanoma, Hodgkins lymphoma and primary mediastinal large B-cell lymphoma (4-7). Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKA Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clonality: Monoclonal
Clone Designation: [4D6]
NCBI: 74766
UniProt: Q9BQ51
Purity: Purified
Form: Supplied as a liquid in PBS, pH 7.4.