S100B (Protein S100-B, S-100 Protein beta Chain, S-100 Protein Subunit beta, S100 Calcium-binding Protein B, NEF, S100, S100beta), Clone: [1B2], Mouse, Monoclonal

Catalog Number: USB-368323
Article Name: S100B (Protein S100-B, S-100 Protein beta Chain, S-100 Protein Subunit beta, S100 Calcium-binding Protein B, NEF, S100, S100beta), Clone: [1B2], Mouse, Monoclonal
Biozol Catalog Number: USB-368323
Supplier Catalog Number: 368323
Alternative Catalog Number: USB-368323-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, IHC, WB
Immunogen: Full-length recombinant protein corresponding to aa1-92 from human S100B, fused to GST-Tag. MW of the GST tag alone is 26kD.
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21, however, this gene is located at 21q22.3. This protein may function in Neurite extension, proliferation of melanoma cells, stimulation of Ca2+ fluxes, inhibition of PKC-mediated phosphorylation, astrocytosis and axonal proliferation, and inhibition of microtubule assembly. Chromosomal rearrangements and altered expression of this gene have been implicated in several neurological, neoplastic, and other types of diseases, including Alzheimers disease, Downs syndrome, epilepsy, amyotrophic lateral sclerosis, melanoma, and type I diabetes. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry: paraffin Optimal dilutions to be determined by the researcher. AA Sequence: MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFM AFVAMVTTACHEFFEHE Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clonality: Monoclonal
Clone Designation: [1B2]
NCBI: 006263
UniProt: P04271
Purity: Purified
Form: Supplied as a liquid in PBS, pH 7.4.