Attachment Invasion Locus Protein, Recombinant, Yersinia Enterocolitica, aa24-178, His-SUMO-Tag (Ail)
Biozol Catalog Number:
USB-370507
Supplier Catalog Number:
370507
Alternative Catalog Number:
USB-370507-20,USB-370507-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Promotes the invasion of pathogenic bacteria into eukaryotic cells by an unknown mechanism. Recombinant protein corresponding to aa24-178 from Yersinia enterocolitica Attachment Invasion Locus Protein, fused to 6xHis-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33.2kD AA Sequence: ASESSISIGYAQSHVKENGYTLDNDPKGFNLKYRYELDDNWGVIGSFAYTHQGYDFFYGSNKFGHGDVDYYSVTMGPSFRINEYVSLYGLLGAAHGKVKASVFDESISASKTSMAYGAGVQFNPLPNFVIDASYEYSKLDSIKVGTWMLGAGYRF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted